Fully Human Generated Monoclonal Antibody

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Human Monoclonal Laboratories manufactures the fully human generated monoclonal antibody reagents distributed by Genprice. The Fully Human Generated Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Fully products are available in stock. Specificity: Fully Category: Human Group: Generated Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Generated Monoclonal information

Histamine (HA) Monoclonal Antibody (General), APC-Cy7

4-MAA927Ge21-APC-Cy7
  • EUR 648.00
  • EUR 7197.60
  • EUR 1916.40
  • EUR 859.20
  • EUR 367.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Histamine (HA). This antibody is labeled with APC-Cy7.

Hyaluronic Acid (HA) Monoclonal Antibody (General), APC

4-MAA182Ge21-APC
  • EUR 396.00
  • EUR 3670.80
  • EUR 1029.60
  • EUR 501.60
  • EUR 255.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Hyaluronic Acid (HA). This antibody is labeled with APC.

Hyaluronic Acid (HA) Monoclonal Antibody (General), Cy3

4-MAA182Ge21-Cy3
  • EUR 477.60
  • EUR 4844.40
  • EUR 1323.60
  • EUR 619.20
  • EUR 290.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Hyaluronic Acid (HA). This antibody is labeled with Cy3.

Hyaluronic Acid (HA) Monoclonal Antibody (General), HRP

4-MAA182Ge21-HRP
  • EUR 362.40
  • EUR 3200.40
  • EUR 912.00
  • EUR 454.80
  • EUR 241.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Hyaluronic Acid (HA). This antibody is labeled with HRP.

Hyaluronic Acid (HA) Monoclonal Antibody (General), FITC

4-MAA182Ge21-FITC
  • EUR 340.80
  • EUR 2960.40
  • EUR 847.20
  • EUR 424.80
  • EUR 228.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Hyaluronic Acid (HA). This antibody is labeled with FITC.

Vitamin B6 (VB6) Monoclonal Antibody (General), APC-Cy7

4-MAA916Ge21-APC-Cy7
  • EUR 648.00
  • EUR 7197.60
  • EUR 1916.40
  • EUR 859.20
  • EUR 367.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Vitamin B6 (VB6). This antibody is labeled with APC-Cy7.

Bovine Serum Albumin (BSA) Monoclonal Antibody (General)

4-MAA248Ge21
  • EUR 283.20
  • EUR 2821.20
  • EUR 706.80
  • EUR 354.00
  • EUR 250.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Bovine Serum Albumin (BSA)

Histamine (HA) Monoclonal Antibody (General), Biotinylated

4-MAA927Ge21-Biotin
  • EUR 360.00
  • EUR 2761.20
  • EUR 824.40
  • EUR 438.00
  • EUR 256.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Histamine (HA). This antibody is labeled with Biotin.

Vitamin C (VC) Monoclonal Antibody (General), Biotinylated

4-MAA913Ge21-Biotin
  • EUR 360.00
  • EUR 2761.20
  • EUR 824.40
  • EUR 438.00
  • EUR 256.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Vitamin C (VC). This antibody is labeled with Biotin.

Bovine Serum Albumin (BSA) Monoclonal Antibody (General), PE

4-MAA248Ge21-PE
  • EUR 340.80
  • EUR 2960.40
  • EUR 847.20
  • EUR 424.80
  • EUR 228.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Bovine Serum Albumin (BSA). This antibody is labeled with PE.

Vitamin B6 (VB6) Monoclonal Antibody (General), Biotinylated

4-MAA916Ge21-Biotin
  • EUR 360.00
  • EUR 2761.20
  • EUR 824.40
  • EUR 438.00
  • EUR 256.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Vitamin B6 (VB6). This antibody is labeled with Biotin.

Bovine Serum Albumin (BSA) Monoclonal Antibody (General), APC

4-MAA248Ge21-APC
  • EUR 396.00
  • EUR 3670.80
  • EUR 1029.60
  • EUR 501.60
  • EUR 255.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Bovine Serum Albumin (BSA). This antibody is labeled with APC.

Bovine Serum Albumin (BSA) Monoclonal Antibody (General), Cy3

4-MAA248Ge21-Cy3
  • EUR 477.60
  • EUR 4844.40
  • EUR 1323.60
  • EUR 619.20
  • EUR 290.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Bovine Serum Albumin (BSA). This antibody is labeled with Cy3.

Bovine Serum Albumin (BSA) Monoclonal Antibody (General), HRP

4-MAA248Ge21-HRP
  • EUR 362.40
  • EUR 3200.40
  • EUR 912.00
  • EUR 454.80
  • EUR 241.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Bovine Serum Albumin (BSA). This antibody is labeled with HRP.

Hyaluronic Acid (HA) Monoclonal Antibody (General), APC-Cy7

4-MAA182Ge21-APC-Cy7
  • EUR 648.00
  • EUR 7197.60
  • EUR 1916.40
  • EUR 859.20
  • EUR 367.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Hyaluronic Acid (HA). This antibody is labeled with APC-Cy7.

Bovine Serum Albumin (BSA) Monoclonal Antibody (General), FITC

4-MAA248Ge21-FITC
  • EUR 340.80
  • EUR 2960.40
  • EUR 847.20
  • EUR 424.80
  • EUR 228.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Bovine Serum Albumin (BSA). This antibody is labeled with FITC.

Reverse Triiodothyronine (rT3) Monoclonal Antibody (General)

4-MAC022Ge21
  • EUR 301.20
  • EUR 3091.20
  • EUR 768.00
  • EUR 379.20
  • EUR 258.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against General Reverse Triiodothyronine (rT3)