Monoclonal PP2A alpha and beta Antibody |
|||
AMM03147G | Leading Biology | 0.1ml | EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Human Monoclonal Laboratories manufactures the fully human generated monoclonal antibody reagents distributed by Genprice. The Fully Human Generated Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Fully products are available in stock. Specificity: Fully Category: Human Group: Generated Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 471.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 564 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 474 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 495.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 482.4 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 470.4 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Generated Monoclonal information
Histamine (HA) Monoclonal Antibody (General), APC-Cy7 |
|||
4-MAA927Ge21-APC-Cy7 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Histamine (HA). This antibody is labeled with APC-Cy7. |
Hyaluronic Acid (HA) Monoclonal Antibody (General), APC |
|||
4-MAA182Ge21-APC | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Hyaluronic Acid (HA). This antibody is labeled with APC. |
Hyaluronic Acid (HA) Monoclonal Antibody (General), Cy3 |
|||
4-MAA182Ge21-Cy3 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Hyaluronic Acid (HA). This antibody is labeled with Cy3. |
Hyaluronic Acid (HA) Monoclonal Antibody (General), HRP |
|||
4-MAA182Ge21-HRP | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Hyaluronic Acid (HA). This antibody is labeled with HRP. |
Hyaluronic Acid (HA) Monoclonal Antibody (General), FITC |
|||
4-MAA182Ge21-FITC | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Hyaluronic Acid (HA). This antibody is labeled with FITC. |
Vitamin B6 (VB6) Monoclonal Antibody (General), APC-Cy7 |
|||
4-MAA916Ge21-APC-Cy7 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Vitamin B6 (VB6). This antibody is labeled with APC-Cy7. |
Bovine Serum Albumin (BSA) Monoclonal Antibody (General) |
|||
4-MAA248Ge21 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Bovine Serum Albumin (BSA) |
Histamine (HA) Monoclonal Antibody (General), Biotinylated |
|||
4-MAA927Ge21-Biotin | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Histamine (HA). This antibody is labeled with Biotin. |
Vitamin C (VC) Monoclonal Antibody (General), Biotinylated |
|||
4-MAA913Ge21-Biotin | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Vitamin C (VC). This antibody is labeled with Biotin. |
Bovine Serum Albumin (BSA) Monoclonal Antibody (General), PE |
|||
4-MAA248Ge21-PE | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Bovine Serum Albumin (BSA). This antibody is labeled with PE. |
Vitamin B6 (VB6) Monoclonal Antibody (General), Biotinylated |
|||
4-MAA916Ge21-Biotin | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Vitamin B6 (VB6). This antibody is labeled with Biotin. |
Bovine Serum Albumin (BSA) Monoclonal Antibody (General), APC |
|||
4-MAA248Ge21-APC | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Bovine Serum Albumin (BSA). This antibody is labeled with APC. |
Bovine Serum Albumin (BSA) Monoclonal Antibody (General), Cy3 |
|||
4-MAA248Ge21-Cy3 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Bovine Serum Albumin (BSA). This antibody is labeled with Cy3. |
Bovine Serum Albumin (BSA) Monoclonal Antibody (General), HRP |
|||
4-MAA248Ge21-HRP | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Bovine Serum Albumin (BSA). This antibody is labeled with HRP. |
Hyaluronic Acid (HA) Monoclonal Antibody (General), APC-Cy7 |
|||
4-MAA182Ge21-APC-Cy7 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Hyaluronic Acid (HA). This antibody is labeled with APC-Cy7. |
Bovine Serum Albumin (BSA) Monoclonal Antibody (General), FITC |
|||
4-MAA248Ge21-FITC | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Bovine Serum Albumin (BSA). This antibody is labeled with FITC. |
Reverse Triiodothyronine (rT3) Monoclonal Antibody (General) |
|||
4-MAC022Ge21 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against General Reverse Triiodothyronine (rT3) |