Iga Monoclonal Gammopathics

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Iga Monoclonal Laboratories manufactures the iga monoclonal gammopathics reagents distributed by Genprice. The Iga Monoclonal Gammopathics reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonal Group: Gammopathics

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

Monoclonal PP2A alpha and beta Antibody

0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Gammopathics information

FITC*Monoclonal Mouse Anti- Human IgA

C030649-1ml 1ml
EUR 373.2

Mouse Anti Bovine Iga Monoclonal Antibody,HRP

DMABT-51898MB 0.25 mg
EUR 889.2

Mouse Anti Cat Iga Monoclonal Antibody,Biotin

DMABT-51972MC 0.25 mg
EUR 1070.4

Mouse Anti Human Iga Monoclonal Antibody,FITC

CABT-48819MH 0.1 mg
EUR 889.2

BIOTIN*Monoclonal Mouse Anti- Human IgA

C030849-10ml 10ml
EUR 2148

BIOTIN*Monoclonal Mouse Anti- Human IgA

C030849-1ml 1ml
EUR 424.8

Mouse Anti Monkey Iga Monoclonal Antibody,Biotin

DMABT-48822MM 0.25 mg
EUR 1070.4

Mouse Anti Bovine/Ovine Iga Monoclonal Antibody

DMABT-51900MB 2 ml
EUR 889.2

Anti-Mouse IgA, Rabbit Monoclonal Antibody

A1787-50 each
EUR 444

Rabbit Anti Human JUN Monoclonal Clone IGA-10

IRBAHUJUNIGA10C100UL each
EUR 496
Description: Rabbit Anti Human JUN Monoclonal Clone IGA-10

Mouse Anti-HDM IgA Monoclonal Antibody, Clone G4H9G12

7132 1 mg/ml x 0.1 ml
EUR 238
Description: Mouse Anti-HDM IgA Monoclonal Antibody

Mouse Monoclonal anti-Human CD79a (Iga) Antibody

xAP-0342 100ug
EUR 280

Monkey IgA mouse monoclonal antibody, clone IgA5-3B, Biotin

AM01151BT-N 250 µg Ask for price

Mouse Anti-Ovalbumin IgA Monoclonal Antibody, Clone 2G12E12

7090 1 mg/ml x 0.1 ml
EUR 238
Description: Mouse Anti-Ovalbumin IgA Monoclonal Antibody

Monkey IgA mouse monoclonal antibody, clone IgA5-3B, Purified

AM01151PU-N 250 µg Ask for price

Monoclonal CD79a (B-Cell Marker) Antibody, Clone: IGA/764

AMM01637G 7 ml
EUR 580.8
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker). The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC

Monoclonal CD79a (B-Cell Marker) Antibody, Clone: IGA/515

AMM01640G 7 ml
EUR 580.8
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker). The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC