Iga Monoclonal Gammopathics

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Iga Monoclonal Laboratories manufactures the iga monoclonal gammopathics reagents distributed by Genprice. The Iga Monoclonal Gammopathics reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonal Group: Gammopathics

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Gammopathics information

Mouse Anti Bovine/Ovine Iga Monoclonal Antibody

DMABT-51900MB 2 ml
EUR 889.2

Anti-Mouse IgA, Rabbit Monoclonal Antibody

A1787-50 each
EUR 444

Mouse Anti-HDM IgA Monoclonal Antibody, Clone G4H9G12

7132 1 mg/ml x 0.1 ml
EUR 406.26
Description: Mouse Anti-HDM IgA Monoclonal Antibody

Mouse Anti-Ovalbumin IgA Monoclonal Antibody, Clone 2G12E12

7090 1 mg/ml x 0.1 ml
EUR 406.26
Description: Mouse Anti-Ovalbumin IgA Monoclonal Antibody

Anti-Human IgA (?1 & ?2) Rabbit Monoclonal Antibody

A1796-50 each
EUR 352.8

Monoclonal CD79a (B-Cell Marker) Antibody, Clone: IGA/764

AMM01637G 7 ml
EUR 580.8
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker). The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC

Monoclonal CD79a (B-Cell Marker) Antibody, Clone: IGA/515

AMM01640G 7 ml
EUR 580.8
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker). The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC

Rat Anti Mouse Iga Heavy Chain Monoclonal Antibody

CABT-54649RM 0.25 mg
EUR 651.6

Mouse Anti Rat Iga Heavy Chain Monoclonal Antibody

DMABT-49899MR 0.25 mg
EUR 651.6

Rabbit Anti-Human IgA monoclonal antibody, clone KN21-53

CABT-BL8591 100 ul
EUR 932.4

Mouse Anti Human Iga Heavy Chain Monoclonal Antibody

CABT-48821MH 0.2 mg
EUR 889.2

Anti-Human IgA Rabbit Monoclonal Antibody, Clone#RM128

M07514-1 100ug
EUR 450
Description: Anti-Human IgA Rabbit Monoclonal Antibody, Clone#RM128 tested in ICC, IHC, FC, ELISA, reactive to Human

Anti-IgA Rabbit Monoclonal Antibody

M07514 100ug/vial
EUR 476.4
Description: Rabbit Monoclonal IgA Antibody. Validated in IP, IF, WB and tested in Human.

Mouse Anti Human Iga Secretory Chain Monoclonal Antibody

CABT-48824MH 0.2 mg
EUR 889.2

Mouse Anti Rat Iga Heavy Chain Monoclonal Antibody,FITC

DMABT-49898MR 0.5 mg
EUR 889.2

Monoclonal IgA Secretory Component / ECM1 Antibody, Clone: SC05

AMM00642G 7 ml
EUR 580.8
Description: A Monoclonal antibody against Human IgA Secretory Component / ECM1. The antibodies are raised in Mouse and are from clone SC05. This antibody is applicable in IHC, IF, FC

Mouse Anti Rat Iga Heavy Chain Monoclonal Antibody,Biotin

DMABT-49897MR 0.5 mg
EUR 889.2