Monoclonal antibody for SUR1 and SUR2B |
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Iga Monoclonal Laboratories manufactures the iga monoclonal gammopathics reagents distributed by Genprice. The Iga Monoclonal Gammopathics reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonal Group: Gammopathics
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 480 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Gammopathics information
Mouse Anti Monkey Iga Monoclonal Antibody |
DMABT-48823MM |
Creative Diagnostics |
0.25 mg |
EUR 567 |
|
Description: Mouse |
Mouse Anti Horse Iga Monoclonal Antibody |
DMABT-51963MH |
Creative Diagnostics |
2 ml |
EUR 546 |
|
Description: Mouse |
Mouse Anti Human Iga Monoclonal Antibody |
CABT-48820MH |
Creative Diagnostics |
1 mg |
EUR 546 |
|
Description: Mouse |
Mouse anti Human IgA Monoclonal Antibody |
MBS460953-01mg |
MyBiosource |
0.1mg |
EUR 280 |
Mouse anti Human IgA Monoclonal Antibody |
MBS460953-5x01mg |
MyBiosource |
5x0.1mg |
EUR 1215 |
Mouse anti Human IgA Monoclonal Antibody |
MBS460954-01mg |
MyBiosource |
0.1mg |
EUR 280 |
Mouse anti Human IgA Monoclonal Antibody |
MBS460954-5x01mg |
MyBiosource |
5x0.1mg |
EUR 1215 |
Mouse Anti Bovine Iga Monoclonal Antibody |
DMABT-51899MB |
Creative Diagnostics |
0.25 mg |
EUR 546 |
|
Description: Mouse |
Mouse Anti Chicken Iga Monoclonal Antibody |
DMABT-51958MC |
Creative Diagnostics |
0.25 mg |
EUR 546 |
|
Description: Mouse |
IgA (14V16) Rabbit Monoclonal Antibody |
E28M5108 |
EnoGene |
100ul |
EUR 295 |
Monoclonal Anti-human IgA antibody. |
TMI012-0.25MG |
Tribioscience |
0.25mg |
EUR 169 |
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI013. |
Monoclonal Anti-human IgA antibody. |
TMI012-1MG |
Tribioscience |
1mg |
EUR 569 |
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI013. |
Monoclonal Anti-human IgA antibody. |
TMI013-0.25MG |
Tribioscience |
0.25mg |
EUR 169 |
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI012. |
Monoclonal Anti-human IgA antibody. |
TMI013-1MG |
Tribioscience |
1mg |
EUR 569 |
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI012. |
CD79a Recombinant monoclonal antibody (IGA/1790R) |
MBS566843-01mg |
MyBiosource |
0.1mg |
EUR 615 |
CD79a Recombinant monoclonal antibody (IGA/1790R) |
MBS566843-5x01mg |
MyBiosource |
5x0.1mg |
EUR 2720 |