Monoclonal PP2A alpha and beta Antibody |
AMM03147G |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Iga Monoclonal Laboratories manufactures the iga monoclonal gammopathyrguis reagents distributed by Genprice. The Iga Monoclonal Gammopathyrguis reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonal Group: Gammopathyrguis
JBS True Blue |
MiTeGen |
300 µl |
EUR 16 |
Description: JBS True Blue |
Monoclonal PP2A alpha and beta Antibody |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 480 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Gammopathyrguis information
Mouse anti Human IgA Monoclonal Antibody |
MBS460953-01mg |
MyBiosource |
0.1mg |
EUR 280 |
Mouse anti Human IgA Monoclonal Antibody |
MBS460953-5x01mg |
MyBiosource |
5x0.1mg |
EUR 1215 |
Mouse anti Human IgA Monoclonal Antibody |
MBS460954-01mg |
MyBiosource |
0.1mg |
EUR 280 |
Mouse anti Human IgA Monoclonal Antibody |
MBS460954-5x01mg |
MyBiosource |
5x0.1mg |
EUR 1215 |
Monoclonal Anti-human IgA antibody. |
TMI012-0.25MG |
Tribioscience |
0.25mg |
EUR 169 |
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI013. |
Monoclonal Anti-human IgA antibody. |
TMI012-1MG |
Tribioscience |
1mg |
EUR 569 |
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI013. |
Monoclonal Anti-human IgA antibody. |
TMI013-0.25MG |
Tribioscience |
0.25mg |
EUR 169 |
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI012. |
Monoclonal Anti-human IgA antibody. |
TMI013-1MG |
Tribioscience |
1mg |
EUR 569 |
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI012. |
CD79a Recombinant monoclonal antibody (IGA/1790R) |
MBS566843-01mg |
MyBiosource |
0.1mg |
EUR 615 |
CD79a Recombinant monoclonal antibody (IGA/1790R) |
MBS566843-5x01mg |
MyBiosource |
5x0.1mg |
EUR 2720 |
HRP*Monoclonal Mouse Anti- Human IgA |
C030249-10ml |
Unibiotest |
10ml |
EUR 2148 |
HRP*Monoclonal Mouse Anti- Human IgA |
C030249-1ml |
Unibiotest |
1ml |
EUR 424.8 |
FITC*Monoclonal Mouse Anti- Human IgA |
C030649-10ml |
Unibiotest |
10ml |
EUR 2148 |
FITC*Monoclonal Mouse Anti- Human IgA |
C030649-1ml |
Unibiotest |
1ml |
EUR 373.2 |